lixisenatide 🐶 Veterinary Use | Indications/Contra | FAERs-F | FAERs-M | Orange Bk | BioActivity |

Stem definitionDrug idCAS RN
peptides and glycopeptides 4815 320367-13-3

Description:

MoleculeDescription

Molfile Inchi Smiles

Synonyms:

  • adlyxin
  • AVE-0010
  • lixisenatide
  • lyxumia
  • AVE0010
A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).
  • Molecular weight: 4858.56
  • Formula: C215H347N61O65S
  • CLOGP:
  • LIPINSKI: None
  • HAC: 126
  • HDO: 70
  • TPSA: 2060.16
  • ALOGS:
  • ROTB: 169

Drug dosage:

DoseUnitRoute
40 U P
20 mcg P

ADMET properties:

None

Approvals:

DateAgencyCompanyOrphan
May 24, 2013 PMDA Sanofi K.K.
July 27, 2016 FDA SANOFI-AVENTIS US LLC
Feb. 1, 2013 EMA Sanofi-Aventis Groupe

FDA Adverse Event Reporting System (Female)

None

FDA Adverse Event Reporting System (Male)

None

FDA Adverse Event Reporting System (Geriatric)

MedDRA adverse event termLikelihood ratioLikelihood ratio thresholdPatients taking drug having adverse eventPatients taking drug not having adverse eventPatients not taking drug having adverse eventPatients not taking drug not having adverse event
Diabetic ketoacidosis 49.98 46.16 12 143 29833 64468744

FDA Adverse Event Reporting System (Pediatric)

None

Pharmacologic Action:

SourceCodeDescription
ATC A10AE54 ALIMENTARY TRACT AND METABOLISM
DRUGS USED IN DIABETES
INSULINS AND ANALOGUES
Insulins and analogues for injection, long-acting
ATC A10BJ03 ALIMENTARY TRACT AND METABOLISM
DRUGS USED IN DIABETES
BLOOD GLUCOSE LOWERING DRUGS, EXCL. INSULINS
Glucagon-like peptide-1 (GLP-1) analogues
FDA CS M0160181 Glucagon-Like Peptide 1
FDA MoA N0000020058 Glucagon-like Peptide-1 (GLP-1) Agonists
MeSH PA D007004 Hypoglycemic Agents
FDA EPC N0000178480 GLP-1 Receptor Agonist
CHEBI has role CHEBI:35526 antidiabetic
CHEBI has role CHEBI:63726 neuroprotective agents
CHEBI has role CHEBI:71196 GLP-1 receptor agonist

Drug Use (View source of the data)

DiseaseRelationSNOMED_IDDOID
Diabetes mellitus type 2 indication 44054006 DOID:9352




🐶 Veterinary Drug Use

None

🐶 Veterinary products

None

Acid dissociation constants calculated using MoKa v3.0.0

Dissociation levelDissociation constantType (acidic/basic)
pKa1 3.15 acidic
pKa2 3.62 acidic
pKa3 3.86 acidic
pKa4 4.07 acidic
pKa5 4.31 acidic
pKa6 4.6 acidic
pKa7 12.21 acidic
pKa8 12.44 acidic
pKa9 12.46 acidic
pKa10 12.61 acidic
pKa11 12.8 acidic
pKa12 12.94 acidic
pKa13 13.0 acidic
pKa14 13.01 acidic
pKa15 13.16 acidic
pKa16 13.28 acidic
pKa17 13.31 acidic
pKa18 13.37 acidic
pKa19 13.43 acidic
pKa20 13.45 acidic
pKa21 13.6 acidic
pKa22 13.66 acidic
pKa23 13.67 acidic
pKa24 13.79 acidic
pKa25 13.81 acidic
pKa26 13.82 acidic
pKa27 13.96 acidic
pKa28 13.98 acidic
pKa29 11.5 Basic
pKa30 11.39 Basic
pKa31 11.16 Basic
pKa32 10.98 Basic
pKa33 10.81 Basic
pKa34 10.64 Basic
pKa35 10.45 Basic
pKa36 10.23 Basic
pKa37 9.85 Basic
pKa38 7.86 Basic
pKa39 5.98 Basic

Orange Book patent data (new drug applications)

None

Orange Book exclusivity data (new drug applications)

None

Bioactivity Summary:

TargetClassPharosUniProtActionTypeActivity value
(-log[M])
Mechanism
action
Bioact sourceMoA source
Glucagon-like peptide 1 receptor GPCR AGONIST IC50 8.85 SCIENTIFIC LITERATURE IUPHAR

External reference:

IDSource
D09729 KEGG_DRUG
4036289 VANDF
CHEBI:85662 CHEBI
CHEMBL2108336 ChEMBL_ID
C479460 MESH_SUPPLEMENTAL_RECORD_UI
7387 IUPHAR_LIGAND_ID
8970 INN_ID
DB09265 DRUGBANK_ID
74O62BB01U UNII
90472060 PUBCHEM_CID
1440051 RXNORM
244072 MMSL
29296 MMSL
d08068 MMSL
015267 NDDF
708808004 SNOMEDCT_US
763570007 SNOMEDCT_US
C2973895 UMLSCUI

Pharmaceutical products:

ProductCategoryIngredientsNDCFormQuantityRouteMarketingLabel
ADLYXIN HUMAN PRESCRIPTION DRUG LABEL 1 0024-5747 INJECTION, SOLUTION 100 ug SUBCUTANEOUS BLA 33 sections
ADLYXIN HUMAN PRESCRIPTION DRUG LABEL 1 0024-5747 INJECTION, SOLUTION 100 ug SUBCUTANEOUS BLA 33 sections
Soliqua 100/33 HUMAN PRESCRIPTION DRUG LABEL 2 0024-5761 INJECTION, SOLUTION 33 ug SUBCUTANEOUS BLA 33 sections
Soliqua 100/33 HUMAN PRESCRIPTION DRUG LABEL 2 0024-5761 INJECTION, SOLUTION 33 ug SUBCUTANEOUS BLA 33 sections