lixisenatide Indications/Contra | FAERs-F | FAERs-M | Orange Bk | BioActivity |

Stem definitionDrug idCAS RN
peptides and glycopeptides 4815 320367-13-3



Molfile Inchi Smiles


  • adlyxin
  • AVE-0010
  • lyxumia
  • lixisenatide
  • AVE0010
A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).
  • Molecular weight: 4858.56
  • Formula: C215H347N61O65S
  • CLOGP:
  • LIPINSKI: None
  • HAC: 126
  • HDO: 70
  • TPSA: 2060.16
  • ALOGS:
  • ROTB: 169

Drug dosage:

40 U P
20 mcg P

ADMET properties:



May 24, 2013 PMDA Sanofi K.K.
Feb. 1, 2013 EMA Sanofi-Aventis Groupe

FDA Adverse Event Reporting System (Female)


FDA Adverse Event Reporting System (Male)


Pharmacologic Action:

Insulins and analogues for injection, long-acting
Glucagon-like peptide-1 (GLP-1) analogues
FDA CS M0160181 Glucagon-Like Peptide 1
FDA MoA N0000020058 Glucagon-like Peptide-1 (GLP-1) Agonists
FDA EPC N0000178480 GLP-1 Receptor Agonist
MeSH PA D007004 Hypoglycemic Agents
CHEBI has role CHEBI:35526 hypoglycemic drug
CHEBI has role CHEBI:63726 neuroprotective agents
CHEBI has role CHEBI:71196 glucagon-like peptide-1 receptor agonists

Drug Use (View source of the data)

Diabetes mellitus type 2 indication 44054006 DOID:9352

Acid dissociation constants calculated using MoKa v3.0.0

Dissociation levelDissociation constantType (acidic/basic)
pKa1 3.15 acidic
pKa2 3.62 acidic
pKa3 3.86 acidic
pKa4 4.07 acidic
pKa5 4.31 acidic
pKa6 4.6 acidic
pKa7 12.21 acidic
pKa8 12.44 acidic
pKa9 12.46 acidic
pKa10 12.61 acidic
pKa11 12.8 acidic
pKa12 12.94 acidic
pKa13 13.0 acidic
pKa14 13.01 acidic
pKa15 13.16 acidic
pKa16 13.28 acidic
pKa17 13.31 acidic
pKa18 13.37 acidic
pKa19 13.43 acidic
pKa20 13.45 acidic
pKa21 13.6 acidic
pKa22 13.66 acidic
pKa23 13.67 acidic
pKa24 13.79 acidic
pKa25 13.81 acidic
pKa26 13.82 acidic
pKa27 13.96 acidic
pKa28 13.98 acidic
pKa29 11.5 Basic
pKa30 11.39 Basic
pKa31 11.16 Basic
pKa32 10.98 Basic
pKa33 10.81 Basic
pKa34 10.64 Basic
pKa35 10.45 Basic
pKa36 10.23 Basic
pKa37 9.85 Basic
pKa38 7.86 Basic
pKa39 5.98 Basic

Orange Book patent data (new drug applications)


Orange Book exclusivity data (new drug applications)


Bioactivity Summary:

TargetClassPharosUniProtActionTypeActivity value
Bioact sourceMoA source
Glucagon-like peptide 1 receptor GPCR AGONIST IC50 8.84 SCIENTIFIC LITERATURE IUPHAR

External reference:

4036289 VANDF
C4276110 UMLSCUI
90472060 PUBCHEM_CID
8970 INN_ID
1440051 RXNORM
244072 MMSL
29296 MMSL
d08068 MMSL
015267 NDDF
708808004 SNOMEDCT_US
763570007 SNOMEDCT_US

Pharmaceutical products:
