Drug results: 2

insulin glargine A recombinant LONG ACTING INSULIN and HYPOGLYCEMIC AGENT that is used to manage BLOOD GLUCOSE in patients with DIABETES MELLITUS.
lixisenatide A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).

Featured News

Drugcentral 2023 NAR Article

The Latest in Chemistry in Coronavirus Research


Drugs in the News


Makena Venetoclax Dapagliflozin KEYTRUDA Sacubitril LORBRENA Hydroxychloroquine


DrugCentral Search Overview