Drug results: 2

lixisenatide A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).
insulin glargine A recombinant LONG ACTING INSULIN and HYPOGLYCEMIC AGENT that is used to manage BLOOD GLUCOSE in patients with DIABETES MELLITUS.

Featured News

Drugcentral 2023 NAR Article

The Latest in Chemistry in Coronavirus Research


Drugs in the News


Makena Venetoclax Dapagliflozin KEYTRUDA Sacubitril LORBRENA Hydroxychloroquine


DrugCentral Search Overview